BLOC1S1 Antibody

Images

 
Immunohistochemistry-Paraffin: BLOC1S1 Antibody [NBP1-88583] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BLOC1S1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BLOC1S1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BLOC1S1 Protein (NBP1-88583PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BLOC1S1 Antibody

  • biogenesis of lysosomal organelles complex-1, subunit 1
  • BLOC subunit 1
  • BLOC-1 subunit 1
  • BLOS1MICoA
  • FLJ39337
  • FLJ97089
  • GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 1
  • GCN5 general control of amino-acid synthesis 5-like 1 (yeast)
  • GCN5 general control of amino-acid synthesis 5-like 1
  • GCN5L1biogenesis of lysosome-related organelles complex 1 subunit 1
  • GCN5-like protein 1
  • MGC87455
  • MTA1-interacting coactivator
  • Protein RT14
  • RT14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-14357
Species: Hu
Applications: IHC, IHC-P
NBP2-55573
Species: Hu
Applications: ICC/IF
NBP1-92414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31848
Species: Hu
Applications: IHC, IHC-P
NBP1-31029
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-11699
Species: Hu
NBP1-91798
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83549
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55573
Species: Hu
Applications: ICC/IF
NB600-260
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-88583
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for BLOC1S1 Antibody (NBP1-88583) (0)

There are no publications for BLOC1S1 Antibody (NBP1-88583).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLOC1S1 Antibody (NBP1-88583) (0)

There are no reviews for BLOC1S1 Antibody (NBP1-88583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BLOC1S1 Antibody (NBP1-88583) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BLOC1S1 Products

Bioinformatics Tool for BLOC1S1 Antibody (NBP1-88583)

Discover related pathways, diseases and genes to BLOC1S1 Antibody (NBP1-88583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BLOC1S1 Antibody (NBP1-88583)

Discover more about diseases related to BLOC1S1 Antibody (NBP1-88583).
 

Pathways for BLOC1S1 Antibody (NBP1-88583)

View related products by pathway.

PTMs for BLOC1S1 Antibody (NBP1-88583)

Learn more about PTMs related to BLOC1S1 Antibody (NBP1-88583).

Blogs on BLOC1S1

There are no specific blogs for BLOC1S1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BLOC1S1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BLOC1S1