CNIH Antibody

Images

 
Western Blot: CNIH Antibody [NBP1-68915] - Rat Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNIH Antibody Summary

Immunogen
Synthetic peptides corresponding to Cnih (cornichon homolog (Drosophila)) The peptide sequence was selected from the N terminal of Cnih. Peptide sequence AFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNIH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Cnih and was validated on Western blot.
Theoretical MW
15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CNIH Antibody

  • CNIH1
  • CNILMGC117156
  • cornichon homolog (Drosophila)
  • T-cell growth-associated molecule 77
  • TGAM77protein cornichon homolog

Background

The function of Cnih remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30001
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
259-HE
Species: Hu
NBP1-43461
Species: Mu
Applications: Flow, IHC, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
259-HE
Species: Hu
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-22411
Species: Rt
Applications: WB, ICC/IF
NBP1-74080
Species: Hu
Applications: WB
NBP2-14215
Species: Hu
Applications: IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
AF4036
Species: Hu
Applications: WB, Simple Western
NBP2-12553
Species: Hu
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-56848
Species: Hu
Applications: WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CNIH Antibody (NBP1-68915) (0)

There are no publications for CNIH Antibody (NBP1-68915).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNIH Antibody (NBP1-68915) (0)

There are no reviews for CNIH Antibody (NBP1-68915). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNIH Antibody (NBP1-68915) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNIH Products

CNIH NBP1-68915

Bioinformatics Tool for CNIH Antibody (NBP1-68915)

Discover related pathways, diseases and genes to CNIH Antibody (NBP1-68915). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNIH Antibody (NBP1-68915)

Discover more about diseases related to CNIH Antibody (NBP1-68915).
 

Pathways for CNIH Antibody (NBP1-68915)

View related products by pathway.

Blogs on CNIH

There are no specific blogs for CNIH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNIH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNIH
Uniprot