CNGB3 Antibody

Images

 
Western Blot: CNGB3 Antibody [NBP2-84702] - Host: Rabbit. Target Name: CNGB3. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNGB3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CNGB3. Peptide sequence: TNPDPQNAAEPTGTVPEQKEMDPGKEGPNSPQNKPPAAPVINEYADAQLH The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CNGB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNGB3 Antibody

  • cyclic nucleotide gated channel beta 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46273
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP3-03109
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2945
Species: Hu
Applications: WB
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-30032
Species: Hu, Mu, Bv, Ca, Fe, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
H00001406-M02
Species: Hu, Mu, Bv, Fi
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP3-05061
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, ChIP, KD
NBP1-06274
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl
H00000778-A01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-13249
Species: Hu
Applications: IHC, IHC-P
NBP1-82860
Species: Hu
Applications: IHC, IHC-P
NBP2-56113
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CNGB3 Antibody (NBP2-84702) (0)

There are no publications for CNGB3 Antibody (NBP2-84702).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNGB3 Antibody (NBP2-84702) (0)

There are no reviews for CNGB3 Antibody (NBP2-84702). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNGB3 Antibody (NBP2-84702) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CNGB3 Products

Array NBP2-84702

Bioinformatics Tool for CNGB3 Antibody (NBP2-84702)

Discover related pathways, diseases and genes to CNGB3 Antibody (NBP2-84702). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNGB3 Antibody (NBP2-84702)

Discover more about diseases related to CNGB3 Antibody (NBP2-84702).
 

Pathways for CNGB3 Antibody (NBP2-84702)

View related products by pathway.

PTMs for CNGB3 Antibody (NBP2-84702)

Learn more about PTMs related to CNGB3 Antibody (NBP2-84702).

Blogs on CNGB3

There are no specific blogs for CNGB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNGB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNGB3