Cav1.4 Antibody - BSA Free

Cav1.4 Antibody [NBP2-68869] -Staining of human eye,retina shows moderate strong cytoplasmic-membranous positivity.

Cav1.4 Antibody [NBP2-68869] -Staining of human kidney shows strong membranous positivity in cells in tubules.

Cav1.4 Antibody [NBP2-68869] -Staining of human liver shows negative positivity in hepatocytes as expected.

Cav1.4 Antibody [NBP2-68869] -Staining of human skeletal muscle shows negative positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cav1.4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cav1.4 Antibody - BSA Free (NBP2-68869) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNA1F
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  Cav1.4 Recombinant Protein Antigen (NBP2-68869PEP)

Reactivity Notes

Mouse 82%, Rat 83%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Cav1.4 Antibody - BSA Free

• AIED
• CACNA1F
• CACNAF1
• calcium channel, voltage-dependent, L type, alpha 1F subunit
• Cav1.4
• Cav1.4alpha1
• COD4
• CORDX
• CORDX3CSNB2
• CSNB2AAland island eye disease (Forsius-Eriksson ocular albinism, ocular albinismtype 2)
• CSNBX2
• JM8
• JMC8
• OA2COD3
• voltage-dependent L-type calcium channel subunit alpha-1F
• Voltage-gated calcium channel subunit alpha Cav1.4

Background

CACNA1F encodes a member of the alpha-1 subunit family; a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. The alpha-1 subunit has 24 transmembrane segments and forms the pore through which ions pass into the cell. There are multiple isoforms of each of the proteins in the complex, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants of the gene described here have been observed but have not been thoroughly characterized. Mutations in this gene have been shown to cause incomplete X-linked congential stationary night blindness type 2 (CSNB2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CACNA1F