CNAP1 Antibody

Images

 
Western Blot: CNAP1 Antibody [NBP1-88201] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: NTERA-2 High
Immunohistochemistry: CNAP1 Antibody [NBP1-88201] - Staining of human tonsil shows strong cytoplasmic and nuclear positivity in reaction center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DKSVLVCKNAIQLLASFLANNPFSCKLSDADLAGPLQKETQKLQEMRAQRRTAAASAVLDPEEEWEAMLPELKSTLQQLLQLPQGEEEIPEQIA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCAPD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CNAP1 Protein (NBP1-88201PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNAP1 Antibody

  • CAPD2
  • CAP-D2
  • Chromosome condensation-related SMC-associated protein 1
  • Chromosome-associated protein D2
  • CNAP1XCAP-D2 homolog
  • hCAP-D2condensin complex subunit 1
  • KIAA0159chromosome condensation related SMC associated protein 1
  • Non-SMC condensin I complex subunit D2
  • non-SMC condensin I complex, subunit D2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32573
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-373
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB100-1573
Species: Hu
Applications: WB, IP
AF4820
Species: Hu
Applications: WB, IHC
NBP1-86635
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-87294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00814
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79140
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00004675-D01P
Species: Hu
Applications: WB, ICC/IF

Publications for CNAP1 Antibody (NBP1-88201) (0)

There are no publications for CNAP1 Antibody (NBP1-88201).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNAP1 Antibody (NBP1-88201) (0)

There are no reviews for CNAP1 Antibody (NBP1-88201). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNAP1 Antibody (NBP1-88201) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNAP1 Products

Bioinformatics Tool for CNAP1 Antibody (NBP1-88201)

Discover related pathways, diseases and genes to CNAP1 Antibody (NBP1-88201). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNAP1 Antibody (NBP1-88201)

Discover more about diseases related to CNAP1 Antibody (NBP1-88201).
 

Pathways for CNAP1 Antibody (NBP1-88201)

View related products by pathway.

PTMs for CNAP1 Antibody (NBP1-88201)

Learn more about PTMs related to CNAP1 Antibody (NBP1-88201).
 

Research Areas for CNAP1 Antibody (NBP1-88201)

Find related products by research area.

Blogs on CNAP1

There are no specific blogs for CNAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAPD2