CMYA5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CMYA5 Antibody [NBP3-17135] - Staining of human cell line MCF7 shows localization to nuclear speckles & cytosol.S

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CMYA5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CMYA5 Antibody - BSA Free (NBP3-17135) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SDVPKQSVLVSKHHLEAAEDTRVKEPLSSAKSNYAQFISNTSASNADKMVSNKEMPKEPEDTYAKGEDFTVTSKPAGLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CMYA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CMYA5 Antibody - BSA Free

• C5orf10
• cardiomyopathy associated 5
• cardiomyopathy-associated protein 5
• DKFZp451G182
• DKFZp451G223
• DTNBP2
• dystrobrevin-binding protein 2
• genethonin-3
• myospryn
• SPRY domain-containing protein 2
• SPRYD2
• tripartite motif-containing protein 76

Background

CMYA5 was originally identified as the muscle-specific partner of dysbindin, (a component of the biogenesis of lysosome-related organelles complex 1 (BLOC-1)), and as a Mef-2 target gene. CMYA5 interacts with desmin, and this association is important for the proper perinuclear localization of CMYA5 and potentially facilitates lysosome biogenesis and/or positioning. CMYA5 may also be a muscle-specific protein kinase A-anchoring protein that is dysregulated in Duchenne muscular dystrophy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CMYA5