CLTB Antibody - BSA Free

Western Blot: CLTB Antibody [NBP2-55390] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: CLTB Antibody [NBP2-55390] - Staining of human cell line A-431 shows localization to plasma membrane, cytosol & vesicles.

Western Blot: CLTB Antibody [NBP2-55390] - Analysis in human cell line MCF-7 and human cell line RT-4.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLTB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CLTB Antibody - BSA Free (NBP2-55390) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLTB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CLTB Recombinant Protein Antigen (NBP2-55390PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CLTB Antibody - BSA Free

• clathrin light chain B
• clathrin, light chain (Lcb)
• clathrin, light chain B
• clathrin, light polypeptide (Lcb)
• Lcb

Background

Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLTB