CLNS1A Antibody


Western Blot: CLNS1A Antibody [NBP1-69004] - Mouse Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB

Order Details

CLNS1A Antibody Summary

Synthetic peptides corresponding to Clns1a (chloride channel, nucleotide-sensitive, 1A) The peptide sequence was selected from the C terminal of Clns1a. Peptide sequence ALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQA.
This product is specific to Subunit or Isoform: pICln.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Clns1a and was validated on Western blot.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CLNS1A Antibody

  • chloride channel regulatory protein
  • Chloride channel, nucleotide sensitive 1A
  • chloride channel, nucleotide-sensitive, 1A
  • Chloride conductance regulatory protein ICln
  • Chloride ion current inducer protein
  • ClCI
  • CLNS1B
  • i(Cln)
  • ICLN
  • methylosome subunit pICln
  • Reticulocyte pICln
  • reticulocyte protein ICln


The function of Clns1a remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Xp, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, IHC, IHC-P, KO
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for CLNS1A Antibody (NBP1-69004) (0)

There are no publications for CLNS1A Antibody (NBP1-69004).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLNS1A Antibody (NBP1-69004) (0)

There are no reviews for CLNS1A Antibody (NBP1-69004). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLNS1A Antibody (NBP1-69004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional CLNS1A Products

Bioinformatics Tool for CLNS1A Antibody (NBP1-69004)

Discover related pathways, diseases and genes to CLNS1A Antibody (NBP1-69004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLNS1A Antibody (NBP1-69004)

Discover more about diseases related to CLNS1A Antibody (NBP1-69004).

Pathways for CLNS1A Antibody (NBP1-69004)

View related products by pathway.

PTMs for CLNS1A Antibody (NBP1-69004)

Learn more about PTMs related to CLNS1A Antibody (NBP1-69004).

Blogs on CLNS1A

There are no specific blogs for CLNS1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CLNS1A Antibody and receive a gift card or discount.


Gene Symbol CLNS1A