CLNK Antibody

Images

 
Immunohistochemistry-Paraffin: CLNK Antibody [NBP1-93458] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of non-germinal centre cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLNK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QGNRKTTKEGSNDLKFQNFSLPKNRSWPRINSATGQYQRMNKPLLDWERNFAAVLDGAKGHSDDDYDDPELR
Specificity
Specificity of human CLNK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLNK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CLNK Protein (NBP1-93458PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLNK Antibody

  • cytokine-dependent hematopoietic cell linker
  • mast cell immunoreceptor signal transducer
  • MGC35197
  • MIST

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37585
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-85457
Species: Hu
Applications: WB
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
MAB5376
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-83790
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67605
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3857
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
H00008631-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC

Publications for CLNK Antibody (NBP1-93458) (0)

There are no publications for CLNK Antibody (NBP1-93458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLNK Antibody (NBP1-93458) (0)

There are no reviews for CLNK Antibody (NBP1-93458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CLNK Antibody (NBP1-93458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CLNK Products

Bioinformatics Tool for CLNK Antibody (NBP1-93458)

Discover related pathways, diseases and genes to CLNK Antibody (NBP1-93458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLNK Antibody (NBP1-93458)

Discover more about diseases related to CLNK Antibody (NBP1-93458).
 

Pathways for CLNK Antibody (NBP1-93458)

View related products by pathway.

PTMs for CLNK Antibody (NBP1-93458)

Learn more about PTMs related to CLNK Antibody (NBP1-93458).

Blogs on CLNK

There are no specific blogs for CLNK, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLNK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLNK