Home » CLNK » CLNK Antibodies » CLNK Antibody

CLNK Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: CLNK Antibody [NBP1-93458] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of non-germinal centre cells.
Immunohistochemistry-Paraffin: CLNK Antibody [NBP1-93458] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of non-germinal centre cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CLNK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QGNRKTTKEGSNDLKFQNFSLPKNRSWPRINSATGQYQRMNKPLLDWERNFAAVLDGAKGHSDDDYDDPELR
Specificity
Specificity of human CLNK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLNK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CLNK Protein (NBP1-93458PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLNK Antibody

  • cytokine-dependent hematopoietic cell linker
  • mast cell immunoreceptor signal transducer
  • MGC35197
  • MIST

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BLNK Antibody (5G9)
NBP2-37585
Western Blot: BLNK Antibody (5G9) [NBP2-37585] - Western blot analysis using BLNK mouse mAb against NIH/3T3 (1) and BCBL-1 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: BLNK Antibody (5G9) [NBP2-37585] - Immunofluorescence analysis of HepG2 cells using BLNK mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: BLNK Antibody (5G9) [NBP2-37585] - Analysis of human cervical cancer tissues using BLNK mouse mAb with DAB staining.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Pet1 Antibody
NBP2-85457
Western Blot: Pet1 Antibody [NBP2-85457] - Host: Rabbit. Target Name: FEV. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Species: Hu
Applications: WB
SLP-76/LCP2 [p
Tyr145] Antibody (776 ...
MAB7474
Western blot shows lysates of Jurkat human acute T cell leukemia cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 5 minutes. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human Phospho-SLP‑76/LCP2 (Y145) Monoclonal Antibody (Catalog # MAB7474) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Phospho-SLP‑76/LCP2 at approximately 80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 5 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Human SLP‑76/LCP2 (Y145) at approximately 76-80 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Phospho-SLP‑76/LCP2 (Y145) Monoclonal Antibody (Catalog # MAB7474). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
SLP‑76/LCP2 phosphorylated at Y145 was detected in immersion fixed Jurkat human acute T cell leukemia cells treated with (upper panel) or without (lower panel) Pervanadate using Mouse Anti-Human Phospho-SLP‑76/LCP2 (Y145) Monoclonal Antibody (Catalog # MAB7474) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Species: Hu
Applications: WB, Simple Western, ICC
LAT Antibody
NBP2-27104
Western Blot: LAT Antibody [NBP2-27104] - analysis of LAT in mouse thymus tissue lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: LAT Antibody [NBP2-27104] - FFPE human small intestine stained with LAT antibody at 10 ug/mL.
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
CD55/DAF Antibody
(583905) [Unconjugate ...
MAB5376
Western blot shows lysates of mouse splenocytes. PVDF Membrane was probed with 2 µg/mL of Rat Anti-Mouse CD55/DAF Monoclonal Antibody (Catalog # MAB5376) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for CD55/DAF at approximately 60 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of mouse spleen tissue and mouse splenocytes. PVDF membrane was probed with 2 µg/mL of Rat Anti-Mouse CD55/DAF Monoclonal Antibody (Catalog # MAB5376) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for CD55/DAF at approximately 75 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.No bands were observed when using reducing conditions.
Mouse splenocytes were stained with Rat Anti-Mouse CD55/DAF Monoclonal Antibody (Catalog # MAB5376, filled histogram) or isotype control antibody (Catalog # MAB006, open histogram), followed by Phycoerythrin-conjugated Anti-Rat IgG F(ab')2 Secondary Antibody (Catalog # F0105B).
(1 Publication)
Species: Mu
Applications: WB, Flow, CyTOF-ready
DHRS4 Antibody
NBP1-83790
Western Blot: DHRS4 Antibody [NBP1-83790] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: DHRS4 Antibody [NBP1-83790] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.
Species: Hu
Applications: WB, IHC, IHC-P
CD21 Antibody
(SC0681)
NBP2-67605
Western Blot: CD21 Antibody (SC0681) [NBP2-67605] - Analysis of CD21 on different lysates using anti-CD21 antibody at 1/1,000 dilution. Positive control: Lane 1: Daudi Lane 2: Raji
Immunocytochemistry/Immunofluorescence: CD21 Antibody (SC0681) [NBP2-67605] - Staining CD21 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: CD21 Antibody (SC0681) [NBP2-67605] - Analysis of paraffin-embedded human tonsil tissue using anti-CD21 antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
CRIPTO Antibody
NB100-1598
Western Blot: CRIPTO Antibody [NB100-1598] - Total protein from human HeLa, NTERA-2 and spleen and embryonic mouse V6.5 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-Cripto in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: CRIPTO Antibody [NB100-1598] - CRIPTO antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Flow Cytometry: CRIPTO Antibody [NB100-1598] - An intracellular stain was performed on Jurkat with NB100-1598 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Calretinin Antibody
NBP1-88220
Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunocytochemistry/Immunofluorescence: Calretinin Antibody [NBP1-88220] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining in human testis and skeletal muscle tissues using NBP1-88220 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(16 Publications)
Species: Hu
PKC mu Antibody
NBP1-87789
Immunocytochemistry/Immunofluorescence: PKC mu Antibody [NBP1-87789] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PKC mu Antibody [NBP1-87789] - Staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
FYB/ADAP/SLAP130
Antibody [Unconjugate ...
AF3857
Western blot shows nuclear extracts of Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human FYB/ADAP/SLAP130 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3857) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for FYB/ADAP/SLAP130 at approximately 130 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Species: Hu
Applications: WB
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Emerin Antibody
NBP1-87692
Western Blot: Emerin Antibody [NBP1-87692] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Emerin Antibody [NBP1-87692] - Staining of human cell line U-251 MG shows localization to nuclear membrane & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Emerin Antibody [NBP1-87692] - Staining of human skeletal muscle shows moderate nuclear membrane positivity in myocytes.
(5 Publications)
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
GRB2 Antibody
NB100-866
Western Blot: GRB2 Antibody [NB100-866] - (0.05ug/ml) staining of Mouse (A+C) and Rat (B+D) Brain (A+B) and Spleen (C+D) lysates (35ug total protein in RIPA buffer). Primary incubated for 1 hour. Detected by western blot using chemiluminescence.
Immunohistochemistry-Paraffin: GRB2 Antibody [NB100-866] - Negative Control showing staining of paraffin embedded Human Lymph Node, with no primary antibody.
Western Blot: GRB2 Antibody [NB100-866] - (0.03ug/ml) staining of Human (A) and Pig (B) Spleen lysates (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
SKAP55 Antibody
(3D3)
H00008631-M01
Immunohistochemistry: SKAP55 Antibody (3D3) [H00008631-M01] - Human SKAP expression by IHC. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: SKAP55 Antibody (3D3) [H00008631-M01] - Analysis of monoclonal antibody to SCAP1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
(1 Review)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western blot shows lysates of CHP-100 human neuroblastoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Western blot shows recombinant human JNK1, JNK2, and JNK3 (1 ng/lane). PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
JNK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC

Publications for CLNK Antibody (NBP1-93458) (0)

There are no publications for CLNK Antibody (NBP1-93458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLNK Antibody (NBP1-93458) (0)

There are no reviews for CLNK Antibody (NBP1-93458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CLNK Antibody (NBP1-93458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CLNK Products

Bioinformatics Tool for CLNK Antibody (NBP1-93458)

Discover related pathways, diseases and genes to CLNK Antibody (NBP1-93458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLNK Antibody (NBP1-93458)

Discover more about diseases related to CLNK Antibody (NBP1-93458).
 

Pathways for CLNK Antibody (NBP1-93458)

View related products by pathway.

PTMs for CLNK Antibody (NBP1-93458)

Learn more about PTMs related to CLNK Antibody (NBP1-93458).

Blogs on CLNK

There are no specific blogs for CLNK, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLNK Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CLNK