Recombinant Human CLIP3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CLIP3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 447-547 of Human CLIPR-59 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CLIP3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CLIP3 Protein

  • CAP-GLY domain containing linker protein 3
  • CAP-Gly domain-containing linker protein 3
  • CLIP-170-related 59 kDa protein
  • CLIPR-59DKFZp586N1922
  • CLIPR59FLJ33413
  • Cytoplasmic linker protein 170-related 59 kDa protein
  • restin-like 1
  • RSNL1

Background

CLIPR-59 - CLIP-170-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00597
Species: Hu, Mk
Applications: WB, Flow, ICC/IF
AF144
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85569
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-71805
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14279
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CLIP3 Partial Recombinant Protein (H00025999-Q01) (0)

There are no publications for CLIP3 Partial Recombinant Protein (H00025999-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLIP3 Partial Recombinant Protein (H00025999-Q01) (0)

There are no reviews for CLIP3 Partial Recombinant Protein (H00025999-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLIP3 Partial Recombinant Protein (H00025999-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLIP3 Products

Bioinformatics Tool for CLIP3 Partial Recombinant Protein (H00025999-Q01)

Discover related pathways, diseases and genes to CLIP3 Partial Recombinant Protein (H00025999-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLIP3 Partial Recombinant Protein (H00025999-Q01)

Discover more about diseases related to CLIP3 Partial Recombinant Protein (H00025999-Q01).
 

Pathways for CLIP3 Partial Recombinant Protein (H00025999-Q01)

View related products by pathway.

Blogs on CLIP3

There are no specific blogs for CLIP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Glut4 Antibody
NBP1-49533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CLIP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLIP3