Claudin-5 Antibody (3D8)

Images

 
Sandwich ELISA: Claudin-5 Antibody (3D8) [H00007122-M01] - Detection limit for recombinant GST tagged CLDN5 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Claudin-5 Antibody (3D8) Summary

Immunogen
CLDN5 (NP_003268, 29 a.a. - 81 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
Specificity
CLDN5 (3D8)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLDN5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Claudin-5 Antibody (3D8)

  • AWAL
  • AWALTransmembrane protein deleted in VCFS
  • BEC1
  • claudin 5
  • Claudin5
  • Claudin-5
  • CLDN5
  • CPETRL1
  • TMDVCF
  • TMVCF1
  • TMVCFTMDVCF
  • transmembrane protein deleted in velocardiofacial syndrome

Background

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Claudin-5 Antibody (H00007122-M01) (0)

There are no publications for Claudin-5 Antibody (H00007122-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-5 Antibody (H00007122-M01) (0)

There are no reviews for Claudin-5 Antibody (H00007122-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Claudin-5 Antibody (H00007122-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Claudin-5 Products

Bioinformatics Tool for Claudin-5 Antibody (H00007122-M01)

Discover related pathways, diseases and genes to Claudin-5 Antibody (H00007122-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-5 Antibody (H00007122-M01)

Discover more about diseases related to Claudin-5 Antibody (H00007122-M01).
 

Pathways for Claudin-5 Antibody (H00007122-M01)

View related products by pathway.

PTMs for Claudin-5 Antibody (H00007122-M01)

Learn more about PTMs related to Claudin-5 Antibody (H00007122-M01).
 

Research Areas for Claudin-5 Antibody (H00007122-M01)

Find related products by research area.

Blogs on Claudin-5

There are no specific blogs for Claudin-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Claudin-5 Antibody (3D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN5
Entrez
OMIM
Uniprot