Claudin-2 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Claudin-2 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-58264PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Claudin-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Claudin-2.

Source: E. coli

Amino Acid Sequence: RSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLDN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58264.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Claudin-2 Recombinant Protein Antigen

  • claudin 2
  • Claudin2
  • Claudin-2
  • CLDN2
  • SP82

Background

The Claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteinsare known to localize to tight junctions, including the Claudins, Occludin and junction adhesion molecule (JAM). Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. Emerging evidence suggests that the Claudin family of proteins regulates transport through tight junctions via differential discrimination for solute size and charge. Claudin expression is often highly restricted to specfic regions of different tissues and may have an important role in transcellular transport through tight junctions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-92405
Species: Hu, Mu, Rt
Applications: WB
MAB4219
Species: Hu
Applications: CyTOF-ready, Flow
NBP3-18555
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, KD, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, KD, WB
NBP2-92846
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DY413
Species: Mu
Applications: ELISA
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP2-49230
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-59157
Species: Hu, Po
Applications: IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB

Publications for Claudin-2 Recombinant Protein Antigen (NBP2-58264PEP) (0)

There are no publications for Claudin-2 Recombinant Protein Antigen (NBP2-58264PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-2 Recombinant Protein Antigen (NBP2-58264PEP) (0)

There are no reviews for Claudin-2 Recombinant Protein Antigen (NBP2-58264PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Claudin-2 Recombinant Protein Antigen (NBP2-58264PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Claudin-2 Products

Research Areas for Claudin-2 Recombinant Protein Antigen (NBP2-58264PEP)

Find related products by research area.

Blogs on Claudin-2

There are no specific blogs for Claudin-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Claudin-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN2