Claudin-19 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Claudin-19 Source: E.coli
Amino Acid Sequence: GDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CLDN19 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24745It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Claudin-19 Recombinant Protein Antigen
Background
The product of this gene belongs to the claudin family. It plays a major role in tight junction-specific obliterationof the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause ofhypomagnesemia renal with ocular involvement (HOMGO). HOMGO is a progressive renal disease characterized by primaryrenal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocularabnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. Twotranscript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC-P, WB
Species: Ca, Hu
Applications: , WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: AC
Publications for Claudin-19 Recombinant Protein Antigen (NBP3-24745PEP) (0)
There are no publications for Claudin-19 Recombinant Protein Antigen (NBP3-24745PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Claudin-19 Recombinant Protein Antigen (NBP3-24745PEP) (0)
There are no reviews for Claudin-19 Recombinant Protein Antigen (NBP3-24745PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Claudin-19 Recombinant Protein Antigen (NBP3-24745PEP) (0)
Additional Claudin-19 Products
Research Areas for Claudin-19 Recombinant Protein Antigen (NBP3-24745PEP)
Find related products by research area.
|
Blogs on Claudin-19