Recombinant Human Claudin-19 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Claudin-19 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 29 - 81 of Human CLDN19 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QWKQSSYAGDAIITAVGPYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSAR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CLDN19

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Claudin-19 Protein

  • claudin 19
  • Claudin19
  • Claudin-19
  • CLDN19

Background

The product of this gene belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO). HOMGO is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocular abnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
MAB4279
Species: Hu
Applications: Flow, CyTOF-ready
NB100-74633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NB600-749
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00140803-R03
Species: Hu
NBP1-60010
Species: Hu
Applications: WB, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
H00149461-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Claudin-19 Partial Recombinant Protein (H00149461-Q01) (0)

There are no publications for Claudin-19 Partial Recombinant Protein (H00149461-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-19 Partial Recombinant Protein (H00149461-Q01) (0)

There are no reviews for Claudin-19 Partial Recombinant Protein (H00149461-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin-19 Partial Recombinant Protein (H00149461-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Claudin-19 Products

Bioinformatics Tool for Claudin-19 Partial Recombinant Protein (H00149461-Q01)

Discover related pathways, diseases and genes to Claudin-19 Partial Recombinant Protein (H00149461-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-19 Partial Recombinant Protein (H00149461-Q01)

Discover more about diseases related to Claudin-19 Partial Recombinant Protein (H00149461-Q01).
 

Pathways for Claudin-19 Partial Recombinant Protein (H00149461-Q01)

View related products by pathway.

PTMs for Claudin-19 Partial Recombinant Protein (H00149461-Q01)

Learn more about PTMs related to Claudin-19 Partial Recombinant Protein (H00149461-Q01).

Blogs on Claudin-19

There are no specific blogs for Claudin-19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Claudin-19 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN19
Entrez