Claudin 10 Antibody - BSA Free

Western Blot: Claudin 10 Antibody [NBP2-92587] - Analysis of extracts of rat lung, using Claudin 10 .Exposure time: 60s.

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Claudin 10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Claudin 10 Antibody - BSA Free (NBP2-92587) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN10 (NP_008915.1). MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLDN10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Claudin 10 Antibody - BSA Free

• claudin 10
• claudin-10
• CPETRL3
• OSP-L
• OSP-like protein

Background

Claudin 10 encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Two alternatively spliced transcript variants that encode different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLDN10