Recombinant Human Clathrin Heavy Chain 1/CHC17 GST (N-Term) Protein

SDS-Page: Recombinant Human Clathrin Heavy Chain 1/CHC17 Protein [H00001213-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human Clathrin Heavy Chain 1/CHC17 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 232-340 of Human Clathrin Heavy Chain 1/CHC17
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: CLTC
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 37.73 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Clathrin Heavy Chain 1/CHC17 GST (N-Term) Protein

• CHC
• CHC17
• Clathrin Heavy Chain 1
• Clathrin heavy chain on chromosome 17
• clathrin, heavy chain (Hc)
• clathrin, heavy chain
• clathrin, heavy polypeptide (Hc)
• clathrin, heavy polypeptide-like 2
• CLH17
• CLH-17
• CLTC
• CLTCL2
• Hc
• KIAA0034

Background

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains (192 kDa) and three light chains (LCa or LCb, 25-29 kDa) and self assembles into a polyhedral cytoskeletal element. Self assembly facilitates clathrin's central role in membrane sorting and selective transport within the cell.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CLTC