Clathrin Heavy Chain 1/CHC17 Antibody (2E5.)

Images

 
Sandwich ELISA: Clathrin Heavy Chain 1/CHC17 Antibody (2E5) [H00001213-M05] - Detection limit for recombinant GST tagged CLTC is 0.3 ng/ml as a capture antibody.
Proximity Ligation Assay: Clathrin Heavy Chain 1/CHC17 Antibody (2E5) [H00001213-M05] - Analysis of protein-protein interactions between HIP1 and CLTC. HeLa cells were stained with anti-HIP1 rabbit purified polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
2E5.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Clathrin Heavy Chain 1/CHC17 Antibody (2E5.) Summary

Immunogen
CLTC (NP_004850 232 a.a. - 340 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN
Marker
Clathrin-coated Vesicle Marker
Specificity
CLTC - clathrin, heavy polypeptide (Hc)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLTC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Clathrin Heavy Chain 1/CHC17 Antibody (2E5.)

  • CHC
  • CHC17
  • Clathrin Heavy Chain 1
  • Clathrin heavy chain on chromosome 17
  • clathrin, heavy chain (Hc)
  • clathrin, heavy chain
  • clathrin, heavy polypeptide (Hc)
  • clathrin, heavy polypeptide-like 2
  • CLH17
  • CLH-17
  • CLTC
  • CLTCL2
  • Hc
  • KIAA0034

Background

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4210
Species: Hu
Applications: WB, IHC

Publications for Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05) (0)

There are no publications for Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05) (0)

There are no reviews for Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Clathrin Heavy Chain 1/CHC17 Products

Bioinformatics Tool for Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05)

Discover related pathways, diseases and genes to Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05)

Discover more about diseases related to Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05).
 

Pathways for Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05)

View related products by pathway.

PTMs for Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05)

Learn more about PTMs related to Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05).
 

Research Areas for Clathrin Heavy Chain 1/CHC17 Antibody (H00001213-M05)

Find related products by research area.

Blogs on Clathrin Heavy Chain 1/CHC17

There are no specific blogs for Clathrin Heavy Chain 1/CHC17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Clathrin Heavy Chain 1/CHC17 Antibody (2E5.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CLTC
Entrez
OMIM
Uniprot