CLASP1 Antibody (6A11) - Azide and BSA Free

Sandwich ELISA: CLASP1 Antibody (6A11) [H00023332-M02] - Detection limit for recombinant GST tagged CLASP1 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6A11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CLASP1 Antibody (6A11) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse CLASP1 Antibody (6A11) - Azide and BSA Free (H00023332-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CLASP1 (NP_056097, 1133 a.a. ~ 1226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT
• Specificity: CLASP1 - cytoplasmic linker associated protein 1
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CLASP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLASP1 Antibody (6A11) - Azide and BSA Free

• CLIP-associating protein 1
• cytoplasmic linker associated protein 1
• Cytoplasmic linker-associated protein 1
• DKFZp686D1968
• DKFZp686H2039
• hOrbit1
• KIAA0622FLJ33821
• MAST1FLJ41222
• MGC131895
• multiple asters 1
• Multiple asters homolog 1
• Protein Orbit homolog 1

Background

CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs (e.g., CLIP170; MIM 179838). CLASP1 is involved in the regulation of microtubule dynamics at the kinetochore and throughout the spindle (Maiato et al., 2003 [PubMed 12837247]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLASP1
• Entrez:
  • 23332(Human)
• OMIM:
  • 605852(Human)
• Uniprot:
  • NP_056097(Human)