CKS2 Antibody - BSA Free

Immunohistochemistry-Paraffin: CKS2 Antibody [NBP1-86336] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: CKS2 Antibody [NBP1-86336] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: CKS2 Antibody [NBP1-86336] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CKS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CKS2 Antibody - BSA Free (NBP1-86336) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CKS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CKS2 Protein (NBP1-86336PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CKS2 Antibody - BSA Free

• CDC28 protein kinase 2
• CDC28 protein kinase regulatory subunit 2
• CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2
• CKS-2
• CKSHS2
• cyclin-dependent kinases regulatory subunit 2

Background

CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CKS2