CKII alpha prime polypeptide Antibody - BSA Free

Western Blot: CKII alpha prime polypeptide Antibody [NBP3-35650] - Western blot analysis of various lysates using CKII alpha prime polypeptide Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Western Blot: CKII alpha prime polypeptide Antibody [NBP3-35650] - Western blot analysis of lysates from HeLa cells, using CKII alpha prime polypeptide Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: CKII alpha prime polypeptide Antibody [NBP3-35650] - Immunofluorescence analysis of NIH/3T3 cells using CKII alpha prime polypeptide Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: CKII alpha prime polypeptide Antibody [NBP3-35650] - Immunofluorescence analysis of PC-12 cells using CKII alpha prime polypeptide Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CKII alpha prime polypeptide Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CKII alpha prime polypeptide Antibody - BSA Free (NBP3-35650) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CKII alpha prime polypeptide (NP_001887.1).
  
  Sequence:
  LGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSNK2A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CKII alpha prime polypeptide Antibody - BSA Free

• casein kinase 2, alpha prime polypeptide
• casein kinase II subunit alpha'
• CK II alpha'
• CK2A2
• CKII alpha prime polypeptide
• CSNK2A1
• CSNK2A2
• EC 2.7.11
• EC 2.7.11.1
• FLJ43934

Background

CKII alpha is involved in leukemogensis and tumorigenesis. It is a catalytic, ubiquitous cellular kinase that can use ATP and GTP as phosphorylation donors. CKII alpha also plays a role in many proliferation-related processes in the cell.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSNK2A2