CKII alpha prime polypeptide Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CKII alpha prime polypeptide Antibody [NBP2-57977] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CKII alpha prime polypeptide Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('EAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR',)
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSNK2A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CKII alpha prime polypeptide Recombinant Protein Antigen (NBP2-57977PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CKII alpha prime polypeptide Antibody - BSA Free

• casein kinase 2, alpha prime polypeptide
• casein kinase II subunit alpha'
• CK II alpha'
• CK2A2
• CKII alpha prime polypeptide
• CSNK2A1
• CSNK2A2
• EC 2.7.11
• EC 2.7.11.1
• FLJ43934

Background

CKII alpha is involved in leukemogensis and tumorigenesis. It is a catalytic, ubiquitous cellular kinase that can use ATP and GTP as phosphorylation donors. CKII alpha also plays a role in many proliferation-related processes in the cell.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSNK2A2