CKAP1 Antibody Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
TBCB (AAH05969, 1 a.a. - 244 a.a.) full-length human protein. MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI |
| Specificity |
TBCB - tubulin folding cofactor B, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
TBCB |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CKAP1 Antibody
Background
CKAP1 binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathwayleading from newly synthesized tubulin to properly folded heterodimer. Involved in regulation of tubulin heterodimerdissociation. May function as
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Rb
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, PLA, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Fu, Gt, Gp, Ha, Hu, Pm, Mu, Pa, Po, Pm, Rb, Rt, Xp, Ye
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, Simple Western, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IP, WB
Species: Bv, Ca, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Ch, Fi, Hu, Pm, Mu, Rt, Re, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: WB
Publications for CKAP1 Antibody (H00001155-B01P) (0)
There are no publications for CKAP1 Antibody (H00001155-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CKAP1 Antibody (H00001155-B01P) (0)
There are no reviews for CKAP1 Antibody (H00001155-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CKAP1 Antibody (H00001155-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CKAP1 Products
Blogs on CKAP1