CKAP1 Antibody

Images

 
Western Blot: CKAP1 Antibody [H00001155-B01P] - Analysis of TBCB expression in K-562.
Western Blot: CKAP1 Antibody [H00001155-B01P] - Analysis of TBCB expression in HeLa.
Western Blot: CKAP1 Antibody [H00001155-B01P] - Analysis of TBCB expression in transfected 293T cell line by TBCB polyclonal antibody. Lane 1: CKAP1 transfected lysate(26.84 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CKAP1 Antibody Summary

Immunogen
TBCB (AAH05969, 1 a.a. - 244 a.a.) full-length human protein. MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Specificity
TBCB - tubulin folding cofactor B,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TBCB
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CKAP1 Antibody

  • CG22Tubulin-specific chaperone B
  • CKAP1MGC14625
  • CKAPI
  • cytoskeleton associated protein 1
  • Cytoskeleton-associated protein 1Cytoskeleton-associated protein CKAPI
  • tubulin folding cofactor B
  • tubulin-folding cofactor B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81711
Species: Hu
Applications: WB, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
AF6657
Species: Hu
Applications: WB, IHC
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-68205
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-690
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Fu, GP, Ha, Mk, Pa, Pm, Rb, Xp, Ye
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, CyTOF-ready, IF
NBP1-30463
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP
NBP1-92691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
7707-NP
Species: Hu
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001155-B01P
Species: Hu
Applications: WB

Publications for CKAP1 Antibody (H00001155-B01P) (0)

There are no publications for CKAP1 Antibody (H00001155-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKAP1 Antibody (H00001155-B01P) (0)

There are no reviews for CKAP1 Antibody (H00001155-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CKAP1 Antibody (H00001155-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CKAP1 Products

Bioinformatics Tool for CKAP1 Antibody (H00001155-B01P)

Discover related pathways, diseases and genes to CKAP1 Antibody (H00001155-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKAP1 Antibody (H00001155-B01P)

Discover more about diseases related to CKAP1 Antibody (H00001155-B01P).
 

Pathways for CKAP1 Antibody (H00001155-B01P)

View related products by pathway.

Blogs on CKAP1

There are no specific blogs for CKAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CKAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBCB
Entrez
Uniprot