CIZ1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CIZ1 Antibody [NBP2-33890] - Staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CIZ1 Antibody [NBP2-33890] - Staining of human vulva/anal skin shows strong nuclear positivity in epidermal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CIZ1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CIZ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reactivity reported in (PMID: 27163549).
Control Peptide
CIZ1 Protein (NBP2-33890PEP)
Publications
Read Publication using
NBP2-33890 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27163549).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CIZ1 Antibody

  • CDKN1A interacting zinc finger protein 1
  • CDKN1A-interacting zinc finger protein 1
  • cip1-interacting zinc finger protein
  • LSFR1ZNF356Nuclear protein NP94
  • NP94
  • Zinc finger protein 356

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00010781-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
NBP2-68858
Species: Hu
Applications: IHC, IHC-P
NBP1-84976
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-1761
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-93163
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03780
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67484
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00009354-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-92392
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-77291
Species: Hu, Mu
Applications: IP, WB
NBP1-84943
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NB120-11433
Species: Hu, Pm, Mu, Rt, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for CIZ1 Antibody (NBP2-33890)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for CIZ1 Antibody (NBP2-33890) (0)

There are no reviews for CIZ1 Antibody (NBP2-33890). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CIZ1 Antibody (NBP2-33890) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CIZ1 Products

Bioinformatics Tool for CIZ1 Antibody (NBP2-33890)

Discover related pathways, diseases and genes to CIZ1 Antibody (NBP2-33890). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIZ1 Antibody (NBP2-33890)

Discover more about diseases related to CIZ1 Antibody (NBP2-33890).
 

Pathways for CIZ1 Antibody (NBP2-33890)

View related products by pathway.

PTMs for CIZ1 Antibody (NBP2-33890)

Learn more about PTMs related to CIZ1 Antibody (NBP2-33890).
 

Research Areas for CIZ1 Antibody (NBP2-33890)

Find related products by research area.

Blogs on CIZ1

There are no specific blogs for CIZ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CIZ1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CIZ1
Uniprot