CIRBP Antibody - BSA Free

Immunohistochemistry: CIRBP Antibody [NBP3-38226] - Immunohistochemistry analysis of paraffin-embedded Human brain using CIRBP Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: CIRBP Antibody [NBP3-38226] - Western blot analysis of lysates from Rat testis, using CIRBP Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Immunohistochemistry: CIRBP Antibody [NBP3-38226] - Immunohistochemistry analysis of paraffin-embedded Human placenta using CIRBP Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: CIRBP Antibody [NBP3-38226] - Immunohistochemistry analysis of paraffin-embedded Rat brain using CIRBP Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CIRBP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CIRBP Antibody - BSA Free (NBP3-38226) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CIRBP (NP_001271.1).
  
  Sequence:
  MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CIRBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:100
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CIRBP Antibody - BSA Free

• A18 hnRNP
• A18HNRNP
• CIRPcold-inducible RNA-binding protein
• cold inducible RNA binding protein
• cold inducible RNA-binding protein
• glycine-rich RNA binding protein
• Glycine-rich RNA-binding protein CIRP

Background

Seems to play an essential role in cold-induced suppression of cell proliferation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CIRBP