We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CILP-1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related CILP-1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-81667PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CILP-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CILP.

Source: E. coli

Amino Acid Sequence: YKHESKLVLRKLQQHQAGEYFCKAQSDAGAVKSKVAQLIVTASDETPCNPVPESYLIRLPHDCFQNATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CILP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81667.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CILP-1 Recombinant Protein Antigen

  • cartilage intermediate layer protein 1 C1
  • cartilage intermediate layer protein 1 C2
  • cartilage intermediate layer protein 1
  • cartilage intermediate layer protein, nucleotide pyrophosphohydrolase
  • Cartilage intermediate-layer protein
  • CILP
  • CILP1
  • CILP-1
  • HsT18872

Background

CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the superficial nor in the deepest layers) and is involved in scaffolding. Overexpression of this protein may lead to impairment of chondrocyte growth and matrix repair and indirectly promote inorganic pyrophosphate (PPi) supersaturation in aging and osteoarthritis cartilage. Antibodies against CILP are detected in patients with early-stage knee osteoarthritis and defects in this gene may be a cause of susceptibility to lumbar disk disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCMP0
Species: Hu
Applications: ELISA
291-G1
Species: Hu
Applications: BA
NBP1-93469
Species: Hu
Applications: IHC,  IHC-P
7754-BH/CF
Species: Hu
Applications: BA
NBP2-27561
Species: Ch, Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP3-06185
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF5945
Species: Hu, Mu, Rt
Applications: WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF8218
Species: Hu
Applications: IHC, WB
NBP1-89787
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
5255-EN
Species: Hu
Applications: EnzAct
NBP1-44643
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF
NBP2-38952
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA

Publications for CILP-1 Protein (NBP1-81667PEP) (0)

There are no publications for CILP-1 Protein (NBP1-81667PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CILP-1 Protein (NBP1-81667PEP) (0)

There are no reviews for CILP-1 Protein (NBP1-81667PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CILP-1 Protein (NBP1-81667PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CILP-1 Products

Research Areas for CILP-1 Protein (NBP1-81667PEP)

Find related products by research area.

Blogs on CILP-1

There are no specific blogs for CILP-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CILP-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CILP