CILP-1 Recombinant Protein Antigen

Product Discontinued

CILP-1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CILP.
  
  

  Source: E. coli

  Amino Acid Sequence: YKHESKLVLRKLQQHQAGEYFCKAQSDAGAVKSKVAQLIVTASDETPCNPVPESYLIRLPHDCFQNATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CILP
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81667.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CILP-1 Recombinant Protein Antigen

• cartilage intermediate layer protein 1 C1
• cartilage intermediate layer protein 1 C2
• cartilage intermediate layer protein 1
• cartilage intermediate layer protein, nucleotide pyrophosphohydrolase
• Cartilage intermediate-layer protein
• CILP
• CILP1
• CILP-1
• HsT18872

Background

CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the superficial nor in the deepest layers) and is involved in scaffolding. Overexpression of this protein may lead to impairment of chondrocyte growth and matrix repair and indirectly promote inorganic pyrophosphate (PPi) supersaturation in aging and osteoarthritis cartilage. Antibodies against CILP are detected in patients with early-stage knee osteoarthritis and defects in this gene may be a cause of susceptibility to lumbar disk disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CILP