CIAPIN1 Antibody

Images

 
Western Blot: CIAPIN1 Antibody [NBP1-89097] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: CIAPIN1 Antibody [NBP1-89097] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: CIAPIN1 Antibody [NBP1-89097] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CIAPIN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CIAPIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CIAPIN1 Protein (NBP1-89097PEP)
Publications
Read Publications using
NBP1-89097 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CIAPIN1 Antibody

  • Anamorsin
  • cytokine induced apoptosis inhibitor 1
  • Cytokine-induced apoptosis inhibitor 1
  • DRE2
  • Fe-S cluster assembly protein DRE2 homolog
  • predicted protein of HQ0915,2810413N20Rik
  • PRO0915

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF7560
Species: Hu, Mu, Rt
Applications: WB
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
AF6108
Species: Hu
Applications: IHC
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NBP1-83537
Species: Hu
Applications: IHC, IHC-P
NBP1-89097
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CIAPIN1 Antibody (NBP1-89097)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 3 of 3.
Publications using NBP1-89097 Applications Species
Nymoen DA, Holth A, Hetland Falkenthal TE et al. CIAPIN1 and ABCA13 are markers of poor survival in metastatic ovarian serous carcinoma. Mol Cancer 2015 [PMID: 25889687]
Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013 Apr [PMID: 23435261]
Nymoen DA, Holth A, Falkenthal THE. CIAPIN1 and ABCA13 are markers of poor survival in metastatic ovarian serous carcinoma Molecular CANCER. 2015 (IHC-P, Human)

Details:
CIAPIN1 antibody was used for IHC-P on formalin-fixed paraffin-embedded tissue sections of human metastatic ovarian serous carcinoma using Dako EnVision Flex + System. Heat induced epitope retrieval was performed using Tris/EDTA buffer pH 6 and the primary antibody was used at 1:100 dilution which was detected using the mentioned kit with DAB as chromogen. Specific immunostaining was observed in cytoplasm, at focal adhesions as well as in nuclei of some specimens (Figure 1).
IHC-P Human

Reviews for CIAPIN1 Antibody (NBP1-89097) (0)

There are no reviews for CIAPIN1 Antibody (NBP1-89097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CIAPIN1 Antibody (NBP1-89097) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CIAPIN1 Products

Bioinformatics Tool for CIAPIN1 Antibody (NBP1-89097)

Discover related pathways, diseases and genes to CIAPIN1 Antibody (NBP1-89097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIAPIN1 Antibody (NBP1-89097)

Discover more about diseases related to CIAPIN1 Antibody (NBP1-89097).
 

Pathways for CIAPIN1 Antibody (NBP1-89097)

View related products by pathway.

Research Areas for CIAPIN1 Antibody (NBP1-89097)

Find related products by research area.

Blogs on CIAPIN1

There are no specific blogs for CIAPIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CIAPIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CIAPIN1