CIAPIN1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CIAPIN1 Antibody [NBP1-89097] - Staining in human testis and skeletal muscle tissues using anti-CIAPIN1 antibody. Corresponding CIAPIN1 RNA-seq data are presented for the same tissues.

Immunohistochemistry: CIAPIN1 Antibody [NBP1-89097] - Ciapin1 protein expression by immunohistochemistry. (A-B) Diffuse Ciapin1 expression (>75% of tumor cells) in the cytoplasm of OC cells in 2 effusions; (C) Focal expression (75% of tumor cells) in the cytoplasm of OC cells in 2 effusions; (C) Focal expression (75% of tumor cells) in the cytoplasm of OC cells in 2 effusions; (C) Focal expression (75% of tumor cells) in the cytoplasm of OC cells in 2 effusions; (C) Focal expression (75% of tumor cells) in the cytoplasm of OC cells in 2 effusions; (C) Focal expression (<5%) in another specimen; (D) Nuclear localization of Ciapin1, an unusual finding in this series. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25889687), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CIAPIN1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CIAPIN1 Antibody - BSA Free (NBP1-89097) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CIAPIN1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CIAPIN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CIAPIN1 Protein (NBP1-89097PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CIAPIN1 Antibody - BSA Free

• Anamorsin
• cytokine induced apoptosis inhibitor 1
• Cytokine-induced apoptosis inhibitor 1
• DRE2
• Fe-S cluster assembly protein DRE2 homolog
• predicted protein of HQ0915,2810413N20Rik
• PRO0915

Background

CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CIAPIN1 Antibody (NBP1-89097)(3)

Publications using NBP1-89097

• Nymoen DA, Holth A, Hetland Falkenthal TE et al. CIAPIN1 and ABCA13 are markers of poor survival in metastatic ovarian serous carcinoma. Mol Cancer 2015-01-01 [PMID: 25889687]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Nymoen DA. Identification of prognostic gene expression signatures in metastatic ovarian carcinoma effusions, primary serous carcinoma and solid metastasis Thesis. 2017-01-01 (IHC-P, Human)

Bioinformatics

• Gene Symbol: CIAPIN1