Recombinant Human CHX10 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CHX10 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 361 of Human CHX10 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA

Protein/Peptide Type
Recombinant Protein
Gene
VSX2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.0

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHX10 Protein

  • ceh-10 homeo domain containing homolog (C. elegans)
  • ceh-10 homeo domain containing homolog
  • ceh-10 homeodomain containing homolog (C. elegans)
  • Ceh-10 homeodomain-containing homolog
  • CHX10MCOPCB3
  • Homeobox protein CHX10
  • HOX10C elegans ceh-10 homeo domain-containing homolog
  • MCOP2
  • RET1
  • visual system homeobox 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NB100-56467
Species: Hu, Ca, Pm
Applications: WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
H00030813-R02
Species: Hu
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006496-M04
Species: Hu
Applications: WB, ELISA
NBP1-82478
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-37619
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88639
Species: Hu, Mu
Applications: IHC, IHC-P
H00338917-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CHX10 Recombinant Protein (H00338917-P01) (0)

There are no publications for CHX10 Recombinant Protein (H00338917-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHX10 Recombinant Protein (H00338917-P01) (0)

There are no reviews for CHX10 Recombinant Protein (H00338917-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHX10 Recombinant Protein (H00338917-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHX10 Products

Bioinformatics Tool for CHX10 Recombinant Protein (H00338917-P01)

Discover related pathways, diseases and genes to CHX10 Recombinant Protein (H00338917-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHX10 Recombinant Protein (H00338917-P01)

Discover more about diseases related to CHX10 Recombinant Protein (H00338917-P01).
 

Pathways for CHX10 Recombinant Protein (H00338917-P01)

View related products by pathway.

PTMs for CHX10 Recombinant Protein (H00338917-P01)

Learn more about PTMs related to CHX10 Recombinant Protein (H00338917-P01).
 

Research Areas for CHX10 Recombinant Protein (H00338917-P01)

Find related products by research area.

Blogs on CHX10

There are no specific blogs for CHX10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CHX10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VSX2