![Western Blot: CHTF18 Antibody [NBP1-57605] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/CHTF18-Antibody-Western-Blot-NBP1-57605-img0002.jpg "Western Blot: CHTF18 Antibody [NBP1-57605] - Human Liver cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to CHTF18 (CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of CHTF18)(50ug).
Peptide sequence QALLLDALCLLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYR The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHTF18 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
![Western Blot Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Western-Blot-NBP2-24457-img0001.jpg)
![Immunohistochemistry-Paraffin Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Immunohistochemistry-Paraffin-NBP2-24457-img0003.jpg)
![Western Blot Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Western-Blot-NBP2-24457-img0005.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot PP2A alpha [p Tyr307] Antibody [Unconjugated]](https://images.novusbio.com/images2/PP2A_AF3989_Western_Blot_5373.jpg)
![Western Blot PP2A alpha [p Tyr307] Antibody [Unconjugated]](https://images.novusbio.com/images/af3989_phospho-pp2a-y307-catalytic-subunit-affinity-purified-pab-western-blot-12122025750418.jpg)
![Western Blot CHL-1/L1CAM-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CHL1_AF2147_Immunohistochemistry_17310.jpg)
![Simple Western CHL-1/L1CAM-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CHL1_AF2147_Simple_Western_18656.jpg)
![Western Blot CHL-1/L1CAM-2 Antibody [Unconjugated]](https://images.novusbio.com/images/af2147_mouse-chl-1-l1cam-2-affinity-purified-polyclonal-ab-412024124025.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")