RFC5 Antibody

Images

 
Western Blot: RFC5 Antibody [NBP1-87137] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RFC5 Antibody [NBP1-87137] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RFC5 Antibody [NBP1-87137] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RFC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RFC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RFC5 Protein (NBP1-87137PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RFC5 Antibody

  • Activator 1 36 kDa subunit
  • Activator 1 subunit 5,36.5 kD subunit
  • MGC1155
  • replication factor C (activator 1) 5, 36.5kDa
  • RF-C 36 kDa subunit
  • RFC36replication factor C (activator 1) 5 (36.5kD)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56070
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-82668
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-03346
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85525
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
409-ML/CF
Species: Mu
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87137
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for RFC5 Antibody (NBP1-87137) (0)

There are no publications for RFC5 Antibody (NBP1-87137).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFC5 Antibody (NBP1-87137) (0)

There are no reviews for RFC5 Antibody (NBP1-87137). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RFC5 Antibody (NBP1-87137) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFC5 Products

Bioinformatics Tool for RFC5 Antibody (NBP1-87137)

Discover related pathways, diseases and genes to RFC5 Antibody (NBP1-87137). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFC5 Antibody (NBP1-87137)

Discover more about diseases related to RFC5 Antibody (NBP1-87137).
 

Pathways for RFC5 Antibody (NBP1-87137)

View related products by pathway.

PTMs for RFC5 Antibody (NBP1-87137)

Learn more about PTMs related to RFC5 Antibody (NBP1-87137).
 

Research Areas for RFC5 Antibody (NBP1-87137)

Find related products by research area.

Blogs on RFC5

There are no specific blogs for RFC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC5