CHST12 Antibody

Images

 
Western Blot: CHST12 Antibody [NBP1-91784] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: CHST12 Antibody [NBP1-91784] - Staining of human cell line A-431 shows positivity in golgi apparatus.
Immunohistochemistry-Paraffin: CHST12 Antibody [NBP1-91784] - Staining of human adrenal gland shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHST12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGKLETLDEDAAQLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD
Specificity
Specificity of human CHST12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHST12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHST12 Protein (NBP1-91784PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHST12 Antibody

  • C4S-2
  • C4ST2C4ST-2
  • carbohydrate (chondroitin 4) sulfotransferase 12
  • carbohydrate sulfotransferase 12
  • Chondroitin 4-O-sulfotransferase 2
  • Chondroitin 4-sulfotransferase 2
  • EC 2.8.2.5
  • Sulfotransferase Hlo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81727
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15898
Species: Hu, Mu
Applications: WB
NBP1-83396
Species: Hu
Applications: IHC, IHC-P
H00166012-P01
Species: Hu
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-91784
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHST12 Antibody (NBP1-91784) (0)

There are no publications for CHST12 Antibody (NBP1-91784).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHST12 Antibody (NBP1-91784) (0)

There are no reviews for CHST12 Antibody (NBP1-91784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHST12 Antibody (NBP1-91784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CHST12 Antibody (NBP1-91784)

Discover related pathways, diseases and genes to CHST12 Antibody (NBP1-91784). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHST12 Antibody (NBP1-91784)

Discover more about diseases related to CHST12 Antibody (NBP1-91784).
 

Pathways for CHST12 Antibody (NBP1-91784)

View related products by pathway.

Blogs on CHST12

There are no specific blogs for CHST12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHST12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST12