CHST11 Antibody


Western Blot: CHST11 Antibody [NBP1-68912] - Rat Kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity RtSpecies Glossary
Applications WB

Order Details

CHST11 Antibody Summary

Synthetic peptides corresponding to Chst11 (carbohydrate (chondroitin 4) sulfotransferase 11) The peptide sequence was selected from the C terminal of Chst11. Peptide sequence FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Chst11 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CHST11 Antibody

  • C4S-1
  • C4ST
  • C4ST-1
  • C4ST1EC
  • carbohydrate (chondroitin 4) sulfotransferase 11
  • carbohydrate sulfotransferase 11
  • Chondroitin 4-O-sulfotransferase 1
  • Chondroitin 4-sulfotransferase 1
  • DKFZp667A035
  • FLJ41682
  • HSA269537
  • IgH/CHST11 fusion


Chst11 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Chst11 can also sulfate Gal residues in desulfated dermatan sulfate. Chst11 preferentially sulfates in GlcA->GalNAc unit than in IdoA->GalNAc unit. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB

Publications for CHST11 Antibody (NBP1-68912) (0)

There are no publications for CHST11 Antibody (NBP1-68912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHST11 Antibody (NBP1-68912) (0)

There are no reviews for CHST11 Antibody (NBP1-68912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHST11 Antibody (NBP1-68912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CHST11 Products

Bioinformatics Tool for CHST11 Antibody (NBP1-68912)

Discover related pathways, diseases and genes to CHST11 Antibody (NBP1-68912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHST11 Antibody (NBP1-68912)

Discover more about diseases related to CHST11 Antibody (NBP1-68912).

Pathways for CHST11 Antibody (NBP1-68912)

View related products by pathway.

PTMs for CHST11 Antibody (NBP1-68912)

Learn more about PTMs related to CHST11 Antibody (NBP1-68912).

Blogs on CHST11

There are no specific blogs for CHST11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CHST11 Antibody and receive a gift card or discount.


Gene Symbol CHST11