CHSS2 Antibody - BSA Free

Western Blot: CHSS2 Antibody [NBP2-82687] - Host: Rabbit. Target Name: CHPF. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CHSS2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHSS2. Peptide sequence: SVTWVEEPCGPGPPQPGDSELPPRGNTNAARRPNSVQPGAEREKPGAGEG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHPF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CHSS2 Antibody - BSA Free

• Chondroitin glucuronyltransferase 2
• chondroitin polymerizing factor
• chondroitin sulfate synthase 2
• Chondroitin-polymerizing factor
• ChPF
• CHSY2
• CSS2FLJ22678
• EC 2.4.1.175
• EC 2.4.1.226
• Glucuronosyl-N-acetylgalactosaminyl-proteoglycan4-beta-N-acetylgalactosaminyltransferase II
• N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase II
• N-acetylgalactosaminyltransferase 2

Background

CHSS2 has both beta-1,3-glucuronic acid and beta-1,4-N-acetylgalactosamine transferase activity. Transfersglucuronic acid (GlcUA) from UDP-GlcUA and N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end ofthe elongating chondroitin polymer

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHPF