CHRFAM7A Antibody


Western Blot: CHRFAM7A Antibody [NBP1-80206] - Human kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CHRFAM7A Antibody Summary

Synthetic peptide directed towards the middle region of human CHRFAM7A. Peptide sequence: DSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLN
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against CHRFAM7A and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CHRFAM7A Antibody

  • CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (familywith sequence similarity 7A, exons A-E) fusion
  • CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) andFAM7A (family with sequence similarity 7A, exons A-E) fusion
  • CHRNA7
  • CHRNA7-DR1alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid
  • CHRNA7-FAM7A fusion protein
  • D-10alpha-7 nicotinic cholinergic receptor subunit
  • MGC120482
  • MGC120483


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, Flow
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for CHRFAM7A Antibody (NBP1-80206) (0)

There are no publications for CHRFAM7A Antibody (NBP1-80206).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHRFAM7A Antibody (NBP1-80206) (0)

There are no reviews for CHRFAM7A Antibody (NBP1-80206). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHRFAM7A Antibody (NBP1-80206) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CHRFAM7A Products

Bioinformatics Tool for CHRFAM7A Antibody (NBP1-80206)

Discover related pathways, diseases and genes to CHRFAM7A Antibody (NBP1-80206). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHRFAM7A Antibody (NBP1-80206)

Discover more about diseases related to CHRFAM7A Antibody (NBP1-80206).

Pathways for CHRFAM7A Antibody (NBP1-80206)

View related products by pathway.

PTMs for CHRFAM7A Antibody (NBP1-80206)

Learn more about PTMs related to CHRFAM7A Antibody (NBP1-80206).

Blogs on CHRFAM7A

There are no specific blogs for CHRFAM7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CHRFAM7A Antibody and receive a gift card or discount.


Gene Symbol CHRFAM7A