CHRFAM7A Antibody - BSA Free Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
Synthetic peptide directed towards the N terminal of human CHRFAM7A. Peptide sequence QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CHRFAM7A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for CHRFAM7A Antibody - BSA Free
Background
CHRFAM7A is a gene that codes for a multi-pass membrane protein expressed in the hippocampus that is 412 amino acids long and weighs approximately 46 kDa. Current studies are being done on diseases and disorders related to this gene including neuronitis, Alzheimer's disease, juvenile myoclonic epilepsy, bipolar affective disorder, schizoaffective disorder, pharyngitis, and dementia. CHRFAM7A has been shown to have involvement in pathways such as the SIDS susceptibility pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Species: Hu, Rt
Applications: ELISA, Flow, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for CHRFAM7A Antibody (NBP1-80091) (0)
There are no publications for CHRFAM7A Antibody (NBP1-80091).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHRFAM7A Antibody (NBP1-80091) (0)
There are no reviews for CHRFAM7A Antibody (NBP1-80091).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CHRFAM7A Antibody (NBP1-80091) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CHRFAM7A Products
Blogs on CHRFAM7A