Cholecystokinin Antibody (2A5)

Images

 
There are currently no images for Cholecystokinin Antibody (H00000885-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cholecystokinin Antibody (2A5) Summary

Immunogen
CCK (AAH08283, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Specificity
CCK - cholecystokinin (2A5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CCK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cholecystokinin Antibody (2A5)

  • CCK
  • cholecystokinin
  • MGC117187

Background

Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48988
Species: Hu
Applications: IHC, IHC-P
NB100-2803
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF2680
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP2-46349
Species: Hu
Applications: IHC, WB
NBP3-03282
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp, Ze
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05167
Species: Hu
Applications: ELISA, IHC, IHC-P, ELISA(Cap), S-ELISA
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB8864
Species: Hu
Applications: IHC
AF4499
Species: Hu, Mu, Rt
Applications: Simple Western, WB
DLP00
Species: Hu
Applications: ELISA
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
H00000885-M02
Species: Hu
Applications: ELISA

Publications for Cholecystokinin Antibody (H00000885-M02) (0)

There are no publications for Cholecystokinin Antibody (H00000885-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cholecystokinin Antibody (H00000885-M02) (0)

There are no reviews for Cholecystokinin Antibody (H00000885-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cholecystokinin Antibody (H00000885-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cholecystokinin Products

Bioinformatics Tool for Cholecystokinin Antibody (H00000885-M02)

Discover related pathways, diseases and genes to Cholecystokinin Antibody (H00000885-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cholecystokinin Antibody (H00000885-M02)

Discover more about diseases related to Cholecystokinin Antibody (H00000885-M02).
 

Pathways for Cholecystokinin Antibody (H00000885-M02)

View related products by pathway.

PTMs for Cholecystokinin Antibody (H00000885-M02)

Learn more about PTMs related to Cholecystokinin Antibody (H00000885-M02).
 

Research Areas for Cholecystokinin Antibody (H00000885-M02)

Find related products by research area.

Blogs on Cholecystokinin

There are no specific blogs for Cholecystokinin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cholecystokinin Antibody (2A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CCK
Entrez
Uniprot