CHMP4C Antibody - Azide and BSA Free

Western Blot: CHMP4C Antibody [H00092421-B01P] - Analysis of CHMP4C expression in transfected 293T cell line by CHMP4C polyclonal antibody. Lane 1: CHMP4C transfected lysate(25.63 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CHMP4C Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse CHMP4C Antibody - Azide and BSA Free (H00092421-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CHMP4C (NP_689497.1, 1 a.a. - 233 a.a.) full-length human protein. MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT
• Specificity: CHMP4C - chromatin modifying protein 4C,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CHMP4C
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CHMP4C Antibody - Azide and BSA Free

• charged multivesicular body protein 4c
• CHMP4c
• chromatin modifying protein 4C
• Chromatin-modifying protein 4c
• hSnf7-3
• hVps32-3
• MGC22825
• SHAX3
• SNF7 homolog associated with Alix 3
• Snf7 homologue associated with Alix 3
• SNF7-3
• Vacuolar protein sorting-associated protein 32-3
• Vps32-3
• VPS32C

Background

CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHMP4C
• Entrez:
  • 92421(Human)
• Uniprot:
  • NP_689497.1(Human)