CHMP2B Antibody

Images

 
Immunohistochemistry-Paraffin: CHMP2B Antibody [NBP1-84482] - Staining of human lymph node shows strong cytoplasmic positivity in subsets of lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHMP2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHMP2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CHMP2B Protein (NBP1-84482PEP)
Publications
Read Publication using NBP1-84482.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHMP2B Antibody

  • charged multivesicular body protein 2b
  • CHMP2.5
  • CHMP2.5VPS2BVPS2-2
  • CHMP2B
  • chromatin modifying protein 2B
  • Chromatin-modifying protein 2b
  • DKFZP564O123
  • DMT1
  • hVps2-2
  • Vacuolar protein sorting-associated protein 2-2
  • vacuolar protein-sorting-associated protein 2-2
  • VPS2 homolog B
  • Vps2-2
  • VPS2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004891-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-21502
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-914
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
AF2420
Species: Hu
Applications: WB, IHC
NBP1-85483
Species: Hu
Applications: IHC, IHC-P
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-84482
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for CHMP2B Antibody (NBP1-84482)(1)

Reviews for CHMP2B Antibody (NBP1-84482) (0)

There are no reviews for CHMP2B Antibody (NBP1-84482). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CHMP2B Antibody (NBP1-84482) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHMP2B Products

Bioinformatics Tool for CHMP2B Antibody (NBP1-84482)

Discover related pathways, diseases and genes to CHMP2B Antibody (NBP1-84482). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHMP2B Antibody (NBP1-84482)

Discover more about diseases related to CHMP2B Antibody (NBP1-84482).
 

Pathways for CHMP2B Antibody (NBP1-84482)

View related products by pathway.

PTMs for CHMP2B Antibody (NBP1-84482)

Learn more about PTMs related to CHMP2B Antibody (NBP1-84482).

Blogs on CHMP2B

There are no specific blogs for CHMP2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHMP2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHMP2B
Entrez