Chitotriosidase/CHIT1 Antibody (1D11)

Images

 
Sandwich ELISA: Chitotriosidase/CHIT1 Antibody (1D11) [H00001118-M01] - Detection limit for recombinant GST tagged CHIT1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Chitotriosidase/CHIT1 Antibody (1D11) Summary

Immunogen
CHIT1 (NP_003456.1, 60 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQE
Specificity
CHIT1 - chitinase 1 (chitotriosidase) (1D11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHIT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Chitotriosidase/CHIT1 Antibody (1D11)

  • CHI3
  • CHIT1
  • CHITCHI3
  • chitinase 1 (chitotriosidase)
  • chitinase-1
  • Chitotriosidase
  • chitotriosidase-1
  • EC 3.2.1.14
  • FLJ00314
  • MGC125322
  • plasma methylumbelliferyl tetra-N-acetylchitotetraoside hydrolase

Background

Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to activated macrophages in culture. Human macrophages can synthesize a functional chitotriosidase, a highly conserved enzyme with a strongly regulated expression. This enzyme may play a role in the degradation of chitin-containing pathogens. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58987
Species: Hu
Applications: WB
210-TA
Species: Hu
Applications: BA
NBP1-83374
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP1-85842
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46516
Species: Hu, Mu, Rt
Applications: IHC, WB
DC3L10
Species: Hu
Applications: ELISA
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-02615
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-10064
Species: Hu
Applications: WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
D6050
Species: Hu
Applications: ELISA
366-6C/CF
Species: Hu
Applications: BA
NBP1-40974
Species: Hu
Applications: ELISA, Flow, IHC, IHC-Fr, IP, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
NBP2-16679
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for Chitotriosidase/CHIT1 Antibody (H00001118-M01) (0)

There are no publications for Chitotriosidase/CHIT1 Antibody (H00001118-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chitotriosidase/CHIT1 Antibody (H00001118-M01) (0)

There are no reviews for Chitotriosidase/CHIT1 Antibody (H00001118-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chitotriosidase/CHIT1 Antibody (H00001118-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Chitotriosidase/CHIT1 Products

Bioinformatics Tool for Chitotriosidase/CHIT1 Antibody (H00001118-M01)

Discover related pathways, diseases and genes to Chitotriosidase/CHIT1 Antibody (H00001118-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chitotriosidase/CHIT1 Antibody (H00001118-M01)

Discover more about diseases related to Chitotriosidase/CHIT1 Antibody (H00001118-M01).
 

Pathways for Chitotriosidase/CHIT1 Antibody (H00001118-M01)

View related products by pathway.

Blogs on Chitotriosidase/CHIT1

There are no specific blogs for Chitotriosidase/CHIT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chitotriosidase/CHIT1 Antibody (1D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CHIT1
Entrez
Uniprot