CHIP/STUB1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STUB1. Source: E. coli
Amino Acid Sequence: LELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
STUB1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47509. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for CHIP/STUB1 Recombinant Protein Antigen
Background
STUB1/CHIP is an E3 ubiquitin ligase and co-chaperone of heat-shock protein 70 (Hsp70). STUB1/CHIP interacts with Hsp70 to monitor protein folding and direct misfolded proteins for proteasomal degradation. It has been found to also associate with Hsp90 to remove phosphorylated protein tau, a protein that accumulates in the brains of Alzheimers and Down's syndrome patients. STUB1/CHIP has been reported to also have intrinsic chaperone activity and recognize non-native proteins in response to heat stress. In this way, STUB1/CHIP has been shown to be a direct chaperone for p53. Alternate names for STUB1/CHIP include carboxy terminus of Hsp70-interacting protein, STIP1 homology and U-box containing protein 1, CLL-associated antigen KW-8 antigen, serologically defined colon cancer antigen 7, heat shock protein A binding protein 2, NY-CO-7, HSPABP2, and SDCCAG7.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Publications for CHIP/STUB1 Protein (NBP2-47509PEP) (0)
There are no publications for CHIP/STUB1 Protein (NBP2-47509PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHIP/STUB1 Protein (NBP2-47509PEP) (0)
There are no reviews for CHIP/STUB1 Protein (NBP2-47509PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for CHIP/STUB1 Protein (NBP2-47509PEP) (0)
Additional CHIP/STUB1 Products
Research Areas for CHIP/STUB1 Protein (NBP2-47509PEP)
Find related products by research area.
|
Blogs on CHIP/STUB1