CHD4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CHD4 Antibody [NBP1-82651] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CHD4 Antibody [NBP1-82651] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHD4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKELGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEDDDDDDSKEP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHD4 Protein (NBP1-82651PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHD4 Antibody

  • ATP-dependent helicase CHD4
  • CHD-4
  • chromodomain helicase DNA binding protein 4
  • chromodomain-helicase-DNA-binding protein 4
  • DKFZp686E06161
  • EC 3.6.1
  • EC 3.6.4.12
  • Mi-2 autoantigen 218 kDa protein
  • Mi-2b
  • Mi2-BETA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51593
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56483
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB600-260
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NBP2-46214
Species: Hu
Applications: WB, IHC
NBP1-83549
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CHD4 Antibody (NBP1-82651) (0)

There are no publications for CHD4 Antibody (NBP1-82651).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHD4 Antibody (NBP1-82651) (0)

There are no reviews for CHD4 Antibody (NBP1-82651). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CHD4 Antibody (NBP1-82651) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHD4 Products

Bioinformatics Tool for CHD4 Antibody (NBP1-82651)

Discover related pathways, diseases and genes to CHD4 Antibody (NBP1-82651). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHD4 Antibody (NBP1-82651)

Discover more about diseases related to CHD4 Antibody (NBP1-82651).
 

Pathways for CHD4 Antibody (NBP1-82651)

View related products by pathway.

PTMs for CHD4 Antibody (NBP1-82651)

Learn more about PTMs related to CHD4 Antibody (NBP1-82651).
 

Research Areas for CHD4 Antibody (NBP1-82651)

Find related products by research area.

Blogs on CHD4

There are no specific blogs for CHD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHD4