CHD1L Antibody (3C1O9)

Western Blot: CHD1L Antibody (3C1O9) [NBP3-15541] - Western blot analysis of extracts of HepG2 cells, using CHD1L Rabbit mAb (NBP3-15541) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

• Reactivity: Hu
• Applications: WB
• Clone: 3C1O9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CHD1L Antibody (3C1O9) Summary

• Description: Novus Biologicals Rabbit CHD1L Antibody (3C1O9) (NBP3-15541) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human CHD1L (NP_004275.). GEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLAL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CHD1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CHD1L Antibody (3C1O9)

• ALC1
• amplified in liver cancer 1
• amplified in liver cancer protein 1
• CHD1L
• CHDL
• chromodomain helicase DNA binding protein 1-like
• chromodomain-helicase-DNA-binding protein 1-like
• FLJ22530

Background

In response to DNA strand breaks, chromatin adopts a relaxed structure due to the addition of poly(ADP-ribose) (PAR) to chromatin proteins by PARP enzymes (see PARP1; MIM 173870), and this relaxation facilitates the repair of DNA damage. CHD1L interacts with PAR and has a role in chromatin relaxation following DNA damage (Ahel et al., 2009 (PubMed 19661379)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHD1L