cGK1/PRKG1 Antibody - BSA Free

Western Blot: cGK1/PRKG1 Antibody [NBP3-38004] - Western blot analysis of lysates from HepG2 cells, using cGK1/PRKG1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

cGK1/PRKG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit cGK1/PRKG1 Antibody - BSA Free (NBP3-38004) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human cGK1/PRKG1 (NP_006249.1).
  
  Sequence:
  MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 76 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for cGK1/PRKG1 Antibody - BSA Free

• AAT8
• cGK 1
• cGK
• cGK1
• cGK1/PRKG1
• cGKI
• cGKI-alpha
• cGKI-BETA
• cGMP-dependent protein kinase I
• DKFZp686K042
• EC 2.7.11
• EC 2.7.11.12
• FLJ36117
• PKG
• PKG1
• PRKG1
• PRKG1B
• PRKG1BMGC71944
• PRKGR1A
• PRKGR1B
• PRKGR1BcGMP-dependent, regulatory, type I, beta
• protein kinase cGMP-dependent 1
• protein kinase, cGMP-dependent, type I

Background

cGK1/PRKG1, also known as cGMP-dependent protein kinase 1, has two isoforms that are produced by alternative splicing. Isoform Alpha (CGK1-alpha) is 671 amino acids long and 76 kDa. Isoform Beta (CGK1-beta) is 686 amino acids long and approximately 78 kDa. PRKG1 is a Serine/threonine protein kinase that is expressed in placenta and lung. cGK1/PRKG1 is an important player in the Nitric Oxide/cGMP Signaling Pathway; the binding of GMP activates PRKG1, which in turn phosphorylates Serine residues and Threonine residues on various cell proteins, including proteins that regulate calcium levels, smooth muscle contraction, platelet adhesion, circadian rhythm and more. Current research on PRKG1 is being conducted in relation to several diseases and disorders including cystic fibrosis, lymphoma, non-small cell lung carcinoma, Wiskott-Aldrich syndrome, Waterhouse-Friderichsen syndrome and myoglobinuria. PRKG1 has also been shown to have interactions with SMAD4, BMPR2, GKAP1, Natriuretic Peptide Receptor A and TFII-I in pathways such as Gap Junction signaling, eNOS signaling and EDNRB signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKG1