CGGBP1 Antibody

Images

 
Western Blot: CGGBP1 Antibody [NBP1-84528] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CGGBP1 Antibody [NBP1-84528] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CGGBP1 Antibody [NBP1-84528] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Western Blot: CGGBP1 Antibody [NBP1-84528] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CGGBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CGGBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CGGBP1 Protein (NBP1-84528PEP)
Publications
Read Publication using NBP1-84528.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CGGBP1 Antibody

  • 20 kDa CGG-binding protein
  • CGG triplet repeat binding protein 1
  • CGG triplet repeat-binding protein 1
  • CGG-binding protein 1
  • CGGBPp20-CGGBP
  • p20-CGG binding protein
  • p20-CGGBP DNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
1670-SE
Species: Ec
H00007541-M02
Species: Hu
Applications: WB, ELISA
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56555
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Pm, Xp
Applications: WB
AF2790
Species: Hu
Applications: WB
NBP1-81480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7635
Species: Hu
Applications: WB
H00084107-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-84528
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CGGBP1 Antibody (NBP1-84528)(1)

Reviews for CGGBP1 Antibody (NBP1-84528) (0)

There are no reviews for CGGBP1 Antibody (NBP1-84528). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CGGBP1 Antibody (NBP1-84528) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CGGBP1 Products

Bioinformatics Tool for CGGBP1 Antibody (NBP1-84528)

Discover related pathways, diseases and genes to CGGBP1 Antibody (NBP1-84528). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CGGBP1 Antibody (NBP1-84528)

Discover more about diseases related to CGGBP1 Antibody (NBP1-84528).
 

Pathways for CGGBP1 Antibody (NBP1-84528)

View related products by pathway.

PTMs for CGGBP1 Antibody (NBP1-84528)

Learn more about PTMs related to CGGBP1 Antibody (NBP1-84528).

Blogs on CGGBP1

There are no specific blogs for CGGBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CGGBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CGGBP1