cGAS Antibody - BSA Free

Western Blot: cGAS Antibody [NBP1-86761] - Analysis in human cell line CACO-2 and human cell line HEK 293

Simple Western: cGAS Antibody [NBP1-86761] - Simple Western lane view shows a specific band for MB21D1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: cGAS Antibody [NBP1-86761] - Electropherogram image(s) of corresponding Simple Western lane view. MB21D1 antibody was used at 1:30 dilution on RT-4 lysate(s).

Analysis in human cell line CACO-2 and human cell line HEK 293.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

cGAS Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CGAS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reactivity reported in scientific literature (PMID: 24970844]
  • Immunohistochemistry Reactivity reported in scientific literature (PMID: 35099823)
  • Simple Western 1:30
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:30, apparent MW was 65 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  cGAS Recombinant Protein Antigen (NBP1-86761PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for cGAS Antibody - BSA Free

• C6orf150
• c-GAS
• cyclic GMP-AMP synthase
• h-cGAS
• Mab-21 domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for cGAS Antibody (NBP1-86761)(11)

Publications using NBP1-86761

• Li K, Gong Y, Qiu D et al. Hyperbaric oxygen facilitates teniposide-induced cGAS-STING activation to enhance the antitumor efficacy of PD-1 antWBody in HCC Journal for immunotherapy of cancer 2022-08-01 [PMID: 36002188] (WB)
• Lohinai Z, Dora D, Caldwell C et al. Loss of STING expression is prognostic in non-small cell lung cancer Journal of surgical oncology 2022-01-31 [PMID: 35099823] (IF/IHC, Human)
• Deater M, Tamhankar M, Lloyd RE. TDRD3 is an antiviral restriction factor that promotes IFN signaling with G3BP1 PLOS Pathogens 2022-01-27 [PMID: 35085371] (Western Blot)
• Luzwick JW, Dombi E, Boisvert RA et al. MRE11-dependent instability in mitochondrial DNA fork protection activates a cGAS immune signaling pathway Science advances 2021-12-17 [PMID: 34910513]
• Nicole Berndt, Christine Wolf, Kristina Fischer, Emanuel Cura Costa, Peter Knuschke, Nick Zimmermann, Franziska Schmidt, Martin Merkel, Osvaldo Chara, Min Ae Lee-Kirsch, Claudia Günther Photosensitivity and cGAS-Dependent IFN-1 Activation in Patients with Lupus and TREX1 Deficiency. The Journal of investigative dermatology 2022-05-09 [PMID: 34400195]
• Schwertner B, Lindner G, Toledo Stauner C et al. Nectin-1 Expression Correlates with the Susceptibility of Malignant Melanoma to Oncolytic Herpes Simplex Virus In Vitro and In Vivo Cancers 2021-06-19 [PMID: 34205379] (IHC-P, Human)
• Chen H, Chen H, Zhang J et al. cGAS suppresses genomic instability as a decelerator of replication forks Sci Adv 2020-10-01 [PMID: 33055160] (ICC/IF, Human)
• Verrier E R, Yim S A et al. Hepatitis B Virus Evasion From Cyclic Guanosine Monophosphate-Adenosine Monophosphate Synthase Sensing in Human Hepatocytes. Hepatology 2018-01-11 [PMID: 29679386] (WB, Human)
• Hansen K, Prabakaran T, Laustsen A et al. Listeria monocytogenes induces IFN-beta expression through an IFI16-, cGAS- and STING-dependent pathway. EMBO J 2014-08-01 [PMID: 24970844] (ICC/IF, Human)
• Berg RK, Rahbek SH, Kofod-Olsen E et al. T Cells Detect Intracellular DNA but Fail to Induce Type I IFN Responses: Implications for Restriction of HIV Replication. PLoS One 2014-01-01 [PMID: 24404168]
• Schoggins JW, MacDuff DA, Imanaka N et al. Pan-viral specificity of IFN-induced genes reveals new roles for cGAS in innate immunity. Nature 2014-01-30 [PMID: 24284630] (WB)

Review for cGAS Antibody (NBP1-86761) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 12/18/2017

Summary

• Application: Western Blot
• Sample Tested: human primary hepatocytes
• Species: Human
• Lot: G105753

Comments

• Comments: Name: Anti-cGAS antibody (NBP1-86761)
  Catalog #: Anti-cGAS antibody (NBP1-86761)
  Lot Number: Anti-cGAS antibody (NBP1-86761, Lot # G105753)
  PO/Order Number: Click here to enter text..
  WB Image Description (Please provide labels for all lanes): lane 1: human primary hepatocytes; lane 2: Hep G2
  Sample Information:
       Cell Line or Tissue: human primary hepatocytes, Hep G2
  Species: human
       Treatment: No
  Lysate Preparation:
       Date of lysate preparation: December 7, 2017
       Lysis buffer used: 1X lysis buffer from Cell Signaling by adding PMSF
  Reducing agent: beta-mercaptoethanol, DTT
  If boiled (temperature/time): Yes
  Controls:
       Positive Control: No
       Negative Control: No
       Loading Control (please attach additional images if applicable): No
  Protein Amount Loaded per lane: 20 ug
  Antibody Storage Conditions: -20℃
  Electrophoresis:
  Gel Percentage: 10%
  Electrophoresis Conditions: Tris-Glycine-SDS at room temperature
       Voltage: 120V
       Time: 2 hours
  Membrane Transfer:
       Method (Submersion/Semi-dry): wet transfer
       Membrane Type (PVDF/Nitrocellulose): Nitrocellulose
       Time: 2 hours
       Voltage: 100V
  Blocking:
       Blocking Solution: 5% milk in 1X TBST
       Time: 1 hour at room temperature
  Primary Antibody:
       Dilution: 1/500
       Diluent Buffer: 2.5% BSA
       Incubation Time: overnight
       Incubation Temperature: 4℃
  Washing Conditions:
       Wash Solution: 1X TBST
       Time and Repetitions: 5 min each for 3 times
  Secondary Antibody
  Manufacturer and Catalog #: Promega, cat # W401B, Lot # 0000187662
  Secondary description: goat anti-rabbit secondary antibody
       Dilution: 1/2000
       Diluent Buffer: 3% milk
       Incubation Time: 1 hour
       Incubation Temperature: room temperature
  Detection Method:
  Detection: ECL (GE, cat # RPN2209, lot #n9838243)
  Procedure: Add equal volume of A and B, mix and apply on the membranes for 3-5 min before exposure
  Development Time: 3 min
  Molecular weight of band(s): ~55 kDa
  Experimental Concerns and Observations: Specific bands around 55 kDa were observed

Bioinformatics

• Gene Symbol: CGAS