cGAS Antibody

Images

 
Western Blot: cGAS Antibody [NBP1-86761] - Analysis in human cell line THP-1.
Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in Hoffbauer cells and placental trophoblast.
Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in lymphoid cells in lamina propria.
Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in macrophages and a subset of leukocytes.
Simple Western: cGAS Antibody [NBP1-86761] - Simple Western lane view shows a specific band for MB21D1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: cGAS Antibody [NBP1-86761] - Electropherogram image(s) of corresponding Simple Western lane view. MB21D1 antibody was used at 1:30 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

cGAS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MB21D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. ICC/IF reactivity reported in scientific literature (PMID: 24970844]).
Control Peptide
cGAS Recombinant Protein Antigen (NBP1-86761PEP)
Publications
Read Publications using
NBP1-86761 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24284630)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for cGAS Antibody

  • C6orf150
  • c-GAS
  • cyclic GMP-AMP synthase
  • h-cGAS
  • Mab-21 domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-30564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89830
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010581-B01P
Species: Hu
Applications: WB, ELISA
7570-GH
Species: Hu
NBP2-29617
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-77314
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-91826
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-07321
Species: Hu
NBL1-11832
Species: Hu
NBP1-87363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57838
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
AF3377
Species: Mu
Applications: WB, IHC
H00004061-D01P
Species: Hu
Applications: WB

Publications for cGAS Antibody (NBP1-86761)(3)

Reviews for cGAS Antibody (NBP1-86761) (0)

There are no reviews for cGAS Antibody (NBP1-86761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for cGAS Antibody (NBP1-86761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional cGAS Products

Bioinformatics Tool for cGAS Antibody (NBP1-86761)

Discover related pathways, diseases and genes to cGAS Antibody (NBP1-86761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for cGAS Antibody (NBP1-86761)

Discover more about diseases related to cGAS Antibody (NBP1-86761).

Blogs on cGAS

There are no specific blogs for cGAS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our cGAS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MB21D1