cGAS Antibody

Images

 
Genetic Strategies: Western Blot: cGAS Antibody [NBP1-86761] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-MB21D1 antibody. Remaining relative intensity is ...read more
Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells
Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Staining of human tonsil shows moderate to strong granular cytoplasmic positivity in non-germinal center and germinal center cells.
Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
Simple Western: cGAS Antibody [NBP1-86761] - Simple Western lane view shows a specific band for MB21D1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: cGAS Antibody [NBP1-86761] - Electropherogram image(s) of corresponding Simple Western lane view. MB21D1 antibody was used at 1:30 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

cGAS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF
Specificity
Specificity of human cGAS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MB21D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000-1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. ICC/IF reactivity reported in scientific literature (PMID: 24970844]).
Control Peptide
cGAS Recombinant Protein Antigen (NBP1-86761PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-86761 in the following applications:

Publications
Read Publications using
NBP1-86761 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24284630).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for cGAS Antibody

  • C6orf150
  • c-GAS
  • cyclic GMP-AMP synthase
  • h-cGAS
  • Mab-21 domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-1244
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27419
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-23795
Species: Hu, Rt
Applications: WB
NBP2-75696
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-30564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89830
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010581-M14
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP1-76977
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-94867
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-81712
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-87363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57838
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67330
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-75533
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-86761
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Publications for cGAS Antibody (NBP1-86761)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for cGAS Antibody (NBP1-86761) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-86761:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot cGAS NBP1-86761
Enlarge
reviewed by:
Anonymous
WB Human 12/18/2017
View

Summary

ApplicationWestern Blot
Sample Testedhuman primary hepatocytes
SpeciesHuman
LotG105753

Comments

CommentsName: Anti-cGAS antibody (NBP1-86761)
Catalog #: Anti-cGAS antibody (NBP1-86761)
Lot Number: Anti-cGAS antibody (NBP1-86761, Lot # G105753)
PO/Order Number: Click here to enter text..
WB Image Description (Please provide labels for all lanes): lane 1: human primary hepatocytes; lane 2: Hep G2
Sample Information:
     Cell Line or Tissue: human primary hepatocytes, Hep G2
Species: human
     Treatment: No
Lysate Preparation:
     Date of lysate preparation: December 7, 2017
     Lysis buffer used: 1X lysis buffer from Cell Signaling by adding PMSF
Reducing agent: beta-mercaptoethanol, DTT
If boiled (temperature/time): Yes
Controls:
     Positive Control: No
     Negative Control: No
     Loading Control (please attach additional images if applicable): No
Protein Amount Loaded per lane: 20 ug
Antibody Storage Conditions: -20℃
Electrophoresis:
Gel Percentage: 10%
Electrophoresis Conditions: Tris-Glycine-SDS at room temperature
     Voltage: 120V
     Time: 2 hours
Membrane Transfer:
     Method (Submersion/Semi-dry): wet transfer
     Membrane Type (PVDF/Nitrocellulose): Nitrocellulose
     Time: 2 hours
     Voltage: 100V
Blocking:
     Blocking Solution: 5% milk in 1X TBST
     Time: 1 hour at room temperature
Primary Antibody:
     Dilution: 1/500
     Diluent Buffer: 2.5% BSA
     Incubation Time: overnight
     Incubation Temperature: 4℃
Washing Conditions:
     Wash Solution: 1X TBST
     Time and Repetitions: 5 min each for 3 times
Secondary Antibody
Manufacturer and Catalog #: Promega, cat # W401B, Lot # 0000187662
Secondary description: goat anti-rabbit secondary antibody
     Dilution: 1/2000
     Diluent Buffer: 3% milk
     Incubation Time: 1 hour
     Incubation Temperature: room temperature
Detection Method:
Detection: ECL (GE, cat # RPN2209, lot #n9838243)
Procedure: Add equal volume of A and B, mix and apply on the membranes for 3-5 min before exposure
Development Time: 3 min
Molecular weight of band(s): ~55 kDa
Experimental Concerns and Observations: Specific bands around 55 kDa were observed

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for cGAS Antibody (NBP1-86761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional cGAS Products

Bioinformatics Tool for cGAS Antibody (NBP1-86761)

Discover related pathways, diseases and genes to cGAS Antibody (NBP1-86761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for cGAS Antibody (NBP1-86761)

Discover more about diseases related to cGAS Antibody (NBP1-86761).

Blogs on cGAS

There are no specific blogs for cGAS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
12/18/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol MB21D1