CFTR Antibody

Images

 
Immunohistochemistry-Paraffin: CFTR Antibody [NBP1-89315] - Staining of human pancreas shows strong membranous positivity in intercalated ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CFTR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:INSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFTR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CFTR Protein (NBP1-89315PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CFTR Antibody

  • ABC35
  • ABCC7CF
  • ATP-binding cassette sub-family C member 7
  • ATP-binding cassette transporter sub-family C member 7
  • cAMP-dependent chloride channel
  • CFTR
  • CFTR/MRP
  • Channel conductance-controlling ATPase
  • cystic fibrosis transmembrane conductance regulator (ATP-binding cassettesub-family C, member 7)
  • cystic fibrosis transmembrane conductance regulator
  • cystic fibrosis transmembrane conductance regulator, ATP-binding cassette(sub-family C, member 7)
  • dJ760C5.1
  • EC 3.6.3
  • MRP7EC 3.6.3.49
  • TNR-CFTR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF3848
Species: Hu
Applications: WB, IHC, IP
NBP2-55967
Species: Hu
Applications: ICC/IF
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for CFTR Antibody (NBP1-89315) (0)

There are no publications for CFTR Antibody (NBP1-89315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CFTR Antibody (NBP1-89315) (0)

There are no reviews for CFTR Antibody (NBP1-89315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CFTR Antibody (NBP1-89315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CFTR Products

Bioinformatics Tool for CFTR Antibody (NBP1-89315)

Discover related pathways, diseases and genes to CFTR Antibody (NBP1-89315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CFTR Antibody (NBP1-89315)

Discover more about diseases related to CFTR Antibody (NBP1-89315).
 

Pathways for CFTR Antibody (NBP1-89315)

View related products by pathway.

PTMs for CFTR Antibody (NBP1-89315)

Learn more about PTMs related to CFTR Antibody (NBP1-89315).
 

Research Areas for CFTR Antibody (NBP1-89315)

Find related products by research area.

Blogs on CFTR.

The ABCA1 Antibody and ABC Transporter Research
The ABC (ATP-binding cassette) transporters are a superfamily of transmembrane proteins which play an essential role in membrane transport in both prokaryotes and eukaryotes. In humans, ABC transporters have been implicated in many conditions. For exa...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CFTR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CFTR
Entrez