CES7 Antibody

Images

 
Western Blot: CES7 Antibody [NBP1-70499] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Western Blot: CES7 Antibody [NBP1-70499] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CES7 Antibody Summary

Immunogen
Synthetic peptides corresponding to CES7(carboxylesterase 7) The peptide sequence was selected from the middle region of CES7. Peptide sequence LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CES5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CES7 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CES7 Antibody

  • carboxylesterase 5A
  • carboxylesterase 7
  • CAUXIN
  • FLJ31547

Background

CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB5657
Species: Hu
Applications: WB, IP, ICC
NBP2-47529
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91620
Species: Mu
Applications: WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
AF2485
Species: Hu
Applications: WB, IHC, IP
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
H00000130-M01
Species: Hu
Applications: WB, ELISA
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF

Publications for CES7 Antibody (NBP1-70499) (0)

There are no publications for CES7 Antibody (NBP1-70499).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CES7 Antibody (NBP1-70499) (0)

There are no reviews for CES7 Antibody (NBP1-70499). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CES7 Antibody (NBP1-70499) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CES7 Products

Bioinformatics Tool for CES7 Antibody (NBP1-70499)

Discover related pathways, diseases and genes to CES7 Antibody (NBP1-70499). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CES7

There are no specific blogs for CES7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CES7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CES5A