![Western Blot: Cerebellin-4 Antibody [NBP2-84664] - WB Suggested Anti-CBLN4 Antibody Titration: 1 ug/ml. Positive Control: Hela cell lysate](http://images.novusbio.com/fullsize/Cerebellin-4-Antibody-Western-Blot-NBP2-84664-img0002.jpg "Western Blot: Cerebellin-4 Antibody [NBP2-84664] - WB Suggested Anti-CBLN4 Antibody Titration: 1 ug/ml. Positive Control: Hela cell lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit Cerebellin-4 Antibody - BSA Free (NBP2-84664) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human Cerebellin-4. Peptide sequence: HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CBLN4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CBLN4 |
![Immunohistochemistry: Cerebellin-4 Antibody [NBP2-84664] - Human cortex](http://images.novusbio.com/fullsize/Cerebellin-4-Antibody-Immunohistochemistry-NBP2-84664-img0003.jpg "Immunohistochemistry: Cerebellin-4 Antibody [NBP2-84664] - Human cortex")
![Immunohistochemistry: Cerebellin-4 Antibody [NBP2-84664] - Immunohistochemistry with Human, cortex tissue at an antibody concentration of 5.0ug/ml using anti-CBLN4 antibody](http://images.novusbio.com/fullsize/Cerebellin-4-Antibody-Immunohistochemistry-NBP2-84664-img0001.jpg "Immunohistochemistry: Cerebellin-4 Antibody [NBP2-84664] - Immunohistochemistry with Human, cortex tissue at an antibody concentration of 5.0ug/ml using anti-CBLN4 antibody")
![Immunocytochemistry SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Immunocytochemistry_15995.jpg)
![Western Blot SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Western_Blot_21580.jpg)
![Simple Western SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Simple_Western_22563.jpg)
![Immunohistochemistry AP-2 gamma Antibody [Unconjugated]](https://images.novusbio.com/images2/AP-2_gamma_AF5059_Immunohistochemistry_6857.jpg)
![Western Blot AP-2 gamma Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5059_human-ap-2-gamma-affinity-purified-polyclonal-ab-western-blot-1732025101610..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
