CBLN3 Antibody


Western Blot: CBLN3 Antibody [NBP1-85844] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: CBLN3 Antibody [NBP1-85844] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CBLN3 Antibody [NBP1-85844] - Staining of human cerebellum shows strong nuclear positivity in a subset of cells of molecular layer.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CBLN3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:GSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQV
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CBLN3 Protein (NBP1-85844PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CBLN3 Antibody

  • cerebellin 3 precursor
  • cerebellin-3
  • PRO1486


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Mu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for CBLN3 Antibody (NBP1-85844) (0)

There are no publications for CBLN3 Antibody (NBP1-85844).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBLN3 Antibody (NBP1-85844) (0)

There are no reviews for CBLN3 Antibody (NBP1-85844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CBLN3 Antibody (NBP1-85844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CBLN3 Products

Bioinformatics Tool for CBLN3 Antibody (NBP1-85844)

Discover related pathways, diseases and genes to CBLN3 Antibody (NBP1-85844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBLN3 Antibody (NBP1-85844)

Discover more about diseases related to CBLN3 Antibody (NBP1-85844).

Pathways for CBLN3 Antibody (NBP1-85844)

View related products by pathway.

PTMs for CBLN3 Antibody (NBP1-85844)

Learn more about PTMs related to CBLN3 Antibody (NBP1-85844).

Blogs on CBLN3

There are no specific blogs for CBLN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CBLN3 Antibody and receive a gift card or discount.


Gene Symbol CBLN3