CEP63 Antibody

Images

 
Immunohistochemistry-Paraffin: CEP63 Antibody [NBP2-31706] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEP63 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHLTQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP63
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CEP63 Protein (NBP2-31706PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEP63 Antibody

  • centrosomal protein 63kDa
  • centrosomal protein of 63 kDa
  • centrosome protein CEP63
  • Cep63
  • FLJ13386
  • MGC78416

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82953
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1384
Species: Hu
Applications: WB, IHC, ICC
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB

Publications for CEP63 Antibody (NBP2-31706) (0)

There are no publications for CEP63 Antibody (NBP2-31706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP63 Antibody (NBP2-31706) (0)

There are no reviews for CEP63 Antibody (NBP2-31706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CEP63 Antibody (NBP2-31706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEP63 Products

Bioinformatics Tool for CEP63 Antibody (NBP2-31706)

Discover related pathways, diseases and genes to CEP63 Antibody (NBP2-31706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP63 Antibody (NBP2-31706)

Discover more about diseases related to CEP63 Antibody (NBP2-31706).
 

Pathways for CEP63 Antibody (NBP2-31706)

View related products by pathway.

PTMs for CEP63 Antibody (NBP2-31706)

Learn more about PTMs related to CEP63 Antibody (NBP2-31706).

Blogs on CEP63

There are no specific blogs for CEP63, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP63 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP63
Uniprot